HPA021149

MRPS30 antibody from Sigma-Aldrich
PAP, PDCD9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021149, RRID:AB_1854128
Product name
Anti-MRPS30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021149
Antibody type
Polyclonal
Antigen
28S ribosomal protein S30, mitochondrial recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYF
SFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLY
ETIEDNDVKGFNDDVLLQIVHFLLNRP
Storage
-20C
Provider Type Product Number
- No reagents -