HPA018686

MRPS30 antibody from Atlas Antibodies
PAP, PDCD9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018686
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018686, RRID:AB_1854127
Product name
Anti-MRPS30
Provider product page
Atlas Antibodies - HPA018686
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVH
RYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAA
LDYRCPVHFYWVRGEEIIPRGH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -