Antibody data

Product number
H00064841-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064841-M10, RRID:AB_1674817
Product name
GNPNAT1 monoclonal antibody (M10), clone 1E9
Provider product page
Abnova Corporation - H00064841-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GNPNAT1.
Antigen sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHP
GEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQ
FMKSFEHMKKSGDYYVTVVE
Isotype
IgG
Antibody clone number
1E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -