SAB1401808

GNPNAT1 antibody from MilliporeSigma / Merck KGaA
FLJ10607, Gpnat1
ELISA
Recommended by provider

Antibody data

Product number
SAB1401808
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401808, RRID:AB_10608017
Product name
Monoclonal Anti-GNPNAT1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401808
Antibody type
Monoclonal
Antigen
GNPNAT1 (NP_932332, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHP
GEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQ
FMKSFEHMKKSGDYYVTVVE*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -