Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA064041 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA064041, RRID:AB_2685181
- Product name
- Anti-ITGA4
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLE
GRPSILEMDETSALKFEIRATGFPEPNPRVIELNK
DENVAHVLLEGLHHQRPKR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection
Månberg A, Bradley F, Qundos U, Guthrie B, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener A, Nilsson P, Broliden K
Molecular & Cellular Proteomics 2019;18(3):461-476
Molecular & Cellular Proteomics 2019;18(3):461-476
No comments: Submit comment
No validations: Submit validation data