Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183010 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 68 (TRIM68) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM68 antibody: synthetic peptide directed towards the C terminal of human TRIM68
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
RLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEA
HDISF YNVTDCGSHI- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel gene on human chromosome 2p24 is differentially expressed between androgen-dependent and androgen-independent prostate cancer cells.
Chang GT, Steenbeek M, Schippers E, Blok LJ, van Weerden WM, van Alewijk DC, Eussen BH, van Steenbrugge GJ, Brinkmann AO
European journal of cancer (Oxford, England : 1990) 2001 Nov;37(16):2129-34
European journal of cancer (Oxford, England : 1990) 2001 Nov;37(16):2129-34
No comments: Submit comment
No validations: Submit validation data