HPA023455

TRIM68 antibody from Sigma-Aldrich
FLJ10369, RNF137, SS-56
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023455, RRID:AB_1858319
Product name
Anti-TRIM68 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023455
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 68 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLELNHSELIQQSQVLWRMIAELKERSQRPVRWML
QDIQEVLNRSKSWSLQQPEPISLELKTDCRVLG
Storage
-20C
Provider Type Product Number
- No reagents -