HPA012008

CHD4 antibody from Sigma-Aldrich
Mi-2b, Mi2-BETA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012008
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012008, RRID:AB_1846633
Product name
Anti-CHD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012008
Antibody type
Polyclonal
Antigen
Chromodomain-helicase-DNA-binding protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKK
KPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEE
EVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKR
KEEEEEDDDDDDSKEP
Storage
-20C
Provider Type Product Number
- No reagents -