HPA007386

PRKG2 antibody from Sigma-Aldrich
cGKII, PKG2, PRKGR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007386
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007386, RRID:AB_1079678
Product name
Anti-PRKG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007386
Antibody type
Polyclonal
Antigen
cGMP-dependent protein kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REYHLKELREQLSKQTVAIAELTEELQNKCIQLNK
LQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLH
SRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRK
DSSEKKLITDALNKNQFLKRLDPQQIKDMVE
Storage
-20C
Provider Type Product Number
- No reagents -