Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009612-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009612-A01, RRID:AB_606640
- Product name
- NCOR2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NCOR2.
- Antigen sequence
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHT
DVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLS
EFQPGNERSQELHLRPESHSYLPELGKSEMEFIES
KRPRL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SpliceArray profiling of breast cancer reveals a novel variant of NCOR2/SMRT that is associated with tamoxifen resistance and control of ERα transcriptional activity.
Zhang L, Gong C, Lau SL, Yang N, Wong OG, Cheung AN, Tsang JW, Chan KY, Khoo US
Cancer research 2013 Jan 1;73(1):246-55
Cancer research 2013 Jan 1;73(1):246-55
No comments: Submit comment
No validations: Submit validation data