Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009612-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009612-A01, RRID:AB_606640
- Product name
- NCOR2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NCOR2.
- Antigen sequence
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHT
DVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLS
EFQPGNERSQELHLRPESHSYLPELGKSEMEFIES
KRPRL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SpliceArray profiling of breast cancer reveals a novel variant of NCOR2/SMRT that is associated with tamoxifen resistance and control of ERĪ± transcriptional activity.
Zhang L, Gong C, Lau SL, Yang N, Wong OG, Cheung AN, Tsang JW, Chan KY, Khoo US
Cancer research 2013 Jan 1;73(1):246-55
Cancer research 2013 Jan 1;73(1):246-55
No comments: Submit comment
No validations: Submit validation data