Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405719 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMTC4 antibody: synthetic peptide directed towards the N terminal of human TMTC4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Zebrafish
- Host
- Rabbit
- Antigen sequence
NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPL
TVLTF RINYYLSGGF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
No validations: Submit validation data