Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029731 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029731, RRID:AB_10669869
- Product name
- Anti-GATA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSS
FNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPP
SSLSFGPHHP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Early development of the cochlea of the common marmoset, a non-human primate model.
The common marmoset as suitable nonhuman alternative for the analysis of primate cochlear development.
ERN1 and ALPK1 inhibit differentiation of bi-potential tumor-initiating cells in human breast cancer
Hosoya M, Fujioka M, Okahara J, Yoshimatsu S, Okano H, Ozawa H
Neural development 2022 May 7;17(1):6
Neural development 2022 May 7;17(1):6
The common marmoset as suitable nonhuman alternative for the analysis of primate cochlear development.
Hosoya M, Fujioka M, Murayama AY, Okano H, Ogawa K
The FEBS journal 2021 Jan;288(1):325-353
The FEBS journal 2021 Jan;288(1):325-353
ERN1 and ALPK1 inhibit differentiation of bi-potential tumor-initiating cells in human breast cancer
Strietz J, Stepputtis S, Preca B, Vannier C, Kim M, Castro D, Au Q, Boerries M, Busch H, Aza-Blanc P, Heynen-Genel S, Bronsert P, Kuster B, Stickeler E, Brabletz T, Oshima R, Maurer J
Oncotarget 2016;7(50):83278-83293
Oncotarget 2016;7(50):83278-83293
No comments: Submit comment
No validations: Submit validation data