ABIN404765

GATA3 antibody from antibodies-online
HDR
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN404765
Provider
antibodies-online
Product name
anti-GATA Binding Protein 3 (GATA3) (N-Term) antibody
Provider product page
antibodies-online - ABIN404765
Antibody type
Polyclonal
Antigen
The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
Host
Rabbit
Antigen sequence
MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA
TVQRY PPTHHGSQVC
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -