Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182603 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GATA Binding Protein 3 (GATA3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSR
HMSSL SHISPFSHSS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Repression of interleukin-5 transcription by the glucocorticoid receptor targets GATA3 signaling and involves histone deacetylase recruitment.
Jee YK, Gilmour J, Kelly A, Bowen H, Richards D, Soh C, Smith P, Hawrylowicz C, Cousins D, Lee T, Lavender P
The Journal of biological chemistry 2005 Jun 17;280(24):23243-50
The Journal of biological chemistry 2005 Jun 17;280(24):23243-50
No comments: Submit comment
No validations: Submit validation data