Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003148-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003148-M03, RRID:AB_714734
- Product name
- HMGB2 monoclonal antibody (M03), clone 3C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HMGB2.
- Antigen sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSS
VNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR
YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLF
CSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD
KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGP
GRPTGSKKKNEPEDEEEEEE- Isotype
- IgG
- Antibody clone number
- 3C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of high-mobility group box 2 is associated with tumor aggressiveness and prognosis of hepatocellular carcinoma.
Kwon JH, Kim J, Park JY, Hong SM, Park CW, Hong SJ, Park SY, Choi YJ, Do IG, Joh JW, Kim DS, Choi KY
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Nov 15;16(22):5511-21
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Nov 15;16(22):5511-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HMGB2 monoclonal antibody (M03), clone 3C7 Western Blot analysis of HMGB2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody (M03), clone 3C7.Lane 1: HMGB2 transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HMGB2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HMGB2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol