HPA021069

TPP2 antibody from Sigma-Aldrich
TPPII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021069
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021069, RRID:AB_1858344
Product name
Anti-TPP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021069
Antibody type
Polyclonal
Antigen
Tripeptidyl-peptidase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDC
LVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQE
YGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTH
VASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLS
T
Storage
-20C
Provider Type Product Number
- No reagents -