HPA002235

LNX1 antibody from Atlas Antibodies
LNX, MPDZ, PDZRN2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002235
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002235, RRID:AB_1079261
Product name
Anti-LNX1
Provider product page
Atlas Antibodies - HPA002235
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLEENDRVLAINGHDLRYGSPESAAHLIQASERRV
HLVVSRQVRQRSPDIFQEAGWNSNGSWSPGPGERS
NTPKPLHPTITCHEKVVNIQKDPGESLGMTVAGGA
SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNV
DGVEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -