HPA002320

LMAN1 antibody from Atlas Antibodies
ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002320
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002320, RRID:AB_1079256
Product name
Anti-LMAN1
Provider product page
Atlas Antibodies - HPA002320
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVR
AKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMI
IPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGK
EP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -