HPA002320
antibody from Atlas Antibodies
Targeting: LMAN1
ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002320 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002320, RRID:AB_1079256
- Product name
- Anti-LMAN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVR
AKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMI
IPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGK
EP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references High Frequency of LMAN1 Abnormalities in Colorectal Tumors with Microsatellite Instability
Roeckel N, Woerner S, Kloor M, Yuan Y, Patsos G, Gromes R, Kopitz J, Gebert J
Cancer Research 2009 January;69(1):292-299
Cancer Research 2009 January;69(1):292-299
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity with granular pattern in glandular cells.
- Sample type
- HUMAN