HPA002320

LMAN1 antibody from Sigma-Aldrich
ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002320
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002320, RRID:AB_1079256
Product name
Anti-LMAN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002320
Antibody type
Polyclonal
Antigen
ERGIC-53 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVR
AKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMI
IPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGK
EP
Storage
-20C
Provider Type Product Number
- No reagents -