HPA019827

NUDT5 antibody from Atlas Antibodies
hYSAH1, YSA1H
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019827, RRID:AB_1854704
Product name
Anti-NUDT5
Provider product page
Atlas Antibodies - HPA019827
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPK
PGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDAR
VYSYALALKHANAKPFEVPFLKF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -