HPA019827

NUDT5 antibody from Sigma-Aldrich
hYSAH1, YSA1H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019827, RRID:AB_1854704
Product name
Anti-NUDT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019827
Antibody type
Polyclonal
Antigen
ADP-sugar pyrophosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPK
PGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDAR
VYSYALALKHANAKPFEVPFLKF
Storage
-20C
Provider Type Product Number
- No reagents -