Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28592 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CDK6 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CDK6.
- Antigen sequence
FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQA
FHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKR
ISAYSALSHPYFQDLERCKENLDSHLPPSQNTSEL
N- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4; Lane 2: Human cell line U-251MG sp with CDK6 polyclonal antibody (Cat#PAB28592) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251MG with CDK6 polyclonal antibody (Cat#PAB28592) at 4 ug/ml shows positivity in nucleus but not nucleoli and cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human bone marrow with CDK6 polyclonal antibody (Cat#PAB28592) shows strong nuclear positivity in bone marrow poietic cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)