HPA002637

CDK6 antibody from Atlas Antibodies
PLSTIRE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002637
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002637, RRID:AB_1233820
Product name
Anti-CDK6
Provider product page
Atlas Antibodies - HPA002637
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQA
FHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKR
ISAYSALSHPYFQDLERCKENLDSHLPPSQNTSEL
N
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -