HPA002637

CDK6 antibody from Sigma-Aldrich
PLSTIRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002637, RRID:AB_1846432
Product name
Anti-CDK6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002637
Antibody type
Polyclonal
Antigen
Cell division protein kinase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQA
FHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKR
ISAYSALSHPYFQDLERCKENLDSHLPPSQNTSEL
N
Storage
-20C
Provider Type Product Number
- No reagents -