HPA003635

MAD1L1 antibody from Sigma-Aldrich
HsMAD1, MAD1, PIG9, TP53I9, TXBP181
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003635
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003635, RRID:AB_1853472
Product name
Anti-MAD1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003635
Antibody type
Polyclonal
Antigen
Mitotic spindle assembly checkpoint protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGL
LRAMERGGTVPADLEAAAASLPSSKEVAELKKQVE
SAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDIT
TENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLE
IRRAPPLSNN
Storage
-20C
Provider Type Product Number
- No reagents -