Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023002-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023002-M05, RRID:AB_530019
- Product name
- DAAM1 monoclonal antibody (M05), clone 5D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DAAM1.
- Antigen sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSN
FALQTMEPALPMPPVEELDVMFSELVDELDLTDKH
REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEF
YIDQL- Isotype
- IgG
- Antibody clone number
- 5D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular profile of endothelial invasion of three-dimensional collagen matrices: insights into angiogenic sprout induction in wound healing.
Daam1 regulates the endocytosis of EphB during the convergent extension of the zebrafish notochord.
Su SC, Mendoza EA, Kwak HI, Bayless KJ
American journal of physiology. Cell physiology 2008 Nov;295(5):C1215-29
American journal of physiology. Cell physiology 2008 Nov;295(5):C1215-29
Daam1 regulates the endocytosis of EphB during the convergent extension of the zebrafish notochord.
Kida YS, Sato T, Miyasaka KY, Suto A, Ogura T
Proceedings of the National Academy of Sciences of the United States of America 2007 Apr 17;104(16):6708-13
Proceedings of the National Academy of Sciences of the United States of America 2007 Apr 17;104(16):6708-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3.Lane 1: DAAM1 transfected lysate(122 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DAAM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol