Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051548-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051548-M01, RRID:AB_1137449
- Product name
- SIRT6 monoclonal antibody (M01), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SIRT6.
- Antigen sequence
CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLR
ACRGELRDTILDWEDSLPDRDLALADEASRNADLS
ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTK
HDRHA- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SIRT6 expression is associated with poor prognosis and chemosensitivity in patients with non-small cell lung cancer.
Over expression of wild type or a catalytically dead mutant of Sirtuin 6 does not influence NFκB responses.
Azuma Y, Yokobori T, Mogi A, Altan B, Yajima T, Kosaka T, Onozato R, Yamaki E, Asao T, Nishiyama M, Kuwano H
Journal of surgical oncology 2015 Aug;112(2):231-7
Journal of surgical oncology 2015 Aug;112(2):231-7
Over expression of wild type or a catalytically dead mutant of Sirtuin 6 does not influence NFκB responses.
Grimley R, Polyakova O, Vamathevan J, McKenary J, Hayes B, Patel C, Smith J, Bridges A, Fosberry A, Bhardwaja A, Mouzon B, Chung CW, Barrett N, Richmond N, Modha S, Solari R
PloS one 2012;7(7):e39847
PloS one 2012;7(7):e39847
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SIRT6 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol