HPA014711

EMP2 antibody from Sigma-Aldrich
XMP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014711
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014711, RRID:AB_1848147
Product name
Anti-EMP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014711
Antibody type
Polyclonal
Antigen
Epithelial membrane protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYS
T
Storage
-20C
Provider Type Product Number
- No reagents -