HPA026864

VDAC3 antibody from Sigma-Aldrich
HD-VDAC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026864, RRID:AB_1858733
Product name
Anti-VDAC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026864
Antibody type
Polyclonal
Antigen
Voltage-dependent anion-selective channel protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNT
DNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSG
KLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFE
GWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHT
H
Storage
-20C
Provider Type Product Number
- No reagents -