Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008320-M14 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008320-M14, RRID:AB_875554
- Product name
- EOMES monoclonal antibody (M14), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EOMES.
- Antigen sequence
SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERT
VPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNK
LDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYP
DPTF- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EOMES monoclonal antibody (M14), clone 2D3. Western Blot analysis of EOMES expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EOMES is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol