HPA004341

ASB6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004341
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004341, RRID:AB_1845070
Product name
Anti-ASB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004341
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIFEYQPLVDAILGSLGIQDPERQESLDRPSYVAS
EESRILVLTELLERKAHSPFYQEGVSNALLKMAEL
GLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRN
QPDMVELLVHHGADVNRRD
Storage
-20C
Provider Type Product Number
- No reagents -