ABIN630460

antibody from antibodies-online

Targeting: M6PR CD-M6PR, CD-MPR

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630460 - Provider product page
Provider: antibodies-online
Product name: anti-Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) antibody
Antibody type: Polyclonal
Antigen: M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

M6PR protein structure - ABIN630460 shown in red.