Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004074-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004074-A01, RRID:AB_462789
- Product name
- M6PR polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant M6PR.
- Antigen sequence
QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCR
SKPRNVPAAYRGVGDDQLGEESEERDDHLLPM- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pitchfork regulates primary cilia disassembly and left-right asymmetry.
HGF-induced invasion by prostate tumor cells requires anterograde lysosome trafficking and activity of Na+-H+ exchangers.
Kinzel D, Boldt K, Davis EE, Burtscher I, Trümbach D, Diplas B, Attié-Bitach T, Wurst W, Katsanis N, Ueffing M, Lickert H
Developmental cell 2010 Jul 20;19(1):66-77
Developmental cell 2010 Jul 20;19(1):66-77
HGF-induced invasion by prostate tumor cells requires anterograde lysosome trafficking and activity of Na+-H+ exchangers.
Steffan JJ, Williams BC, Welbourne T, Cardelli JA
Journal of cell science 2010 Apr 1;123(Pt 7):1151-9
Journal of cell science 2010 Apr 1;123(Pt 7):1151-9
No comments: Submit comment
No validations: Submit validation data