HPA016496

EIF2AK1 antibody from Sigma-Aldrich
HRI, KIAA1369
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016496
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016496, RRID:AB_1848057
Product name
Anti-EIF2AK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016496
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 2-alpha kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLL
LVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGL
LSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQD
PCEDISRIQKIRSREVALEAQTSRYLNEFEELAIL
GKGGYGR
Storage
-20C
Provider Type Product Number
- No reagents -