HPA004826

F7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004826
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004826, RRID:AB_10602805
Product name
Anti-F7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004826
Antibody type
Polyclonal
Antigen
coagulation factor VII (serum prothrombin conversion accelerator) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGR
NCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRC
HEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKP
QGRIVGGKVCPKGECPWQVLLLVNGA
Storage
-20C
Provider Type Product Number
- No reagents -