HPA003911

PPFIBP2 antibody from Sigma-Aldrich
Cclp1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003911, RRID:AB_1079666
Product name
Anti-PPFIBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003911
Antibody type
Polyclonal
Antigen
Liprin-beta-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAALHSESHTERDQEIQRLKMGMETLLLANEDKDR
RIEELTGLLNQYRKVKEIVMVTQGPSERTLSINEE
EPEGGFSKWNATNKDPEELFKQEMPPRCSSPTVGP
PPLPQKSLETRAQK
Storage
-20C
Provider Type Product Number
- No reagents -