Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406646 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin-Conjugating Enzyme E2K (UBE2K) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP
PKVRF ITKIWHPNIS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel polysome messages and changes in translational activity appear after induction of adipogenesis in 3T3-L1 cells.
E2-BRCA1 RING interactions dictate synthesis of mono- or specific polyubiquitin chain linkages.
Fromm-Dornieden C, von der Heyde S, Lytovchenko O, Salinas-Riester G, Brenig B, Beissbarth T, Baumgartner BG
BMC molecular biology 2012 Mar 21;13:9
BMC molecular biology 2012 Mar 21;13:9
E2-BRCA1 RING interactions dictate synthesis of mono- or specific polyubiquitin chain linkages.
Christensen DE, Brzovic PS, Klevit RE
Nature structural & molecular biology 2007 Oct;14(10):941-8
Nature structural & molecular biology 2007 Oct;14(10):941-8
No comments: Submit comment
No validations: Submit validation data