Antibody data

Product number
ABIN406646
Provider
antibodies-online
Product name
anti-Ubiquitin-Conjugating Enzyme E2K (UBE2K) (N-Term) antibody
Provider product page
antibodies-online - ABIN406646
Antibody type
Polyclonal
Antigen
The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP
PKVRF ITKIWHPNIS
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -