ABIN502337

UBE2K antibody from antibodies-online
HIP2, HYPG, UBC1

Antibody data

Product number
ABIN502337
Provider
antibodies-online
Product name
anti-Ubiquitin-Conjugating Enzyme E2K (UBE2K) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502337
Antibody type
Polyclonal
Antigen
The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRN
AVIVA LSSKSWDVET
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -