HPA004847

MATK antibody from Sigma-Aldrich
CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004847
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004847, RRID:AB_1079316
Product name
Anti-MATK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004847
Antibody type
Polyclonal
Antigen
Megakaryocyte-associated tyrosine-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTQCITKCEHTRPKPGELAFRKGDVVTILEACENK
SWYRVKHHTSGQEGLLAAGALREREALSADPKLSL
MPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPG
DYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNL
MDMVEHY
Storage
-20C
Provider Type Product Number
- No reagents -