HPA036156

NCF4 antibody from Atlas Antibodies
p40phox, SH3PXD4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036156
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036156, RRID:AB_2674974
Product name
Anti-NCF4
Provider product page
Atlas Antibodies - HPA036156
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGF
TSHFVFVIEVKTKGGSKYLIYRRY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -