HPA002969

SKAP1 antibody from Sigma-Aldrich
SCAP1, SKAP55
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002969
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002969, RRID:AB_1079870
Product name
Anti-SKAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002969
Antibody type
Polyclonal
Antigen
Src kinase-associated phosphoprotein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCR
PTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEE
DESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRG
DL
Storage
-20C
Provider Type Product Number
- No reagents -