Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003680-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003680-M01, RRID:AB_464147
- Product name
- ITGA9 monoclonal antibody (M01), clone 3E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITGA9.
- Antigen sequence
GESVDAANFIQLDDLECHFQPINITLQVYNTGPST
LPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGN
CSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR- Isotype
- IgG
- Antibody clone number
- 3E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Notch-mediated induction of N-cadherin and α9-integrin confers higher invasive phenotype on rhabdomyosarcoma cells.
Osteopontin is an activator of human adipose tissue macrophages and directly affects adipocyte function.
Thrombin-cleaved osteopontin regulates hemopoietic stem and progenitor cell functions through interactions with alpha9beta1 and alpha4beta1 integrins.
An interstitial deletion at 3p21.3 results in the genetic fusion of MLH1 and ITGA9 in a Lynch syndrome family.
Masià A, Almazán-Moga A, Velasco P, Reventós J, Torán N, Sánchez de Toledo J, Roma J, Gallego S
British journal of cancer 2012 Oct 9;107(8):1374-83
British journal of cancer 2012 Oct 9;107(8):1374-83
Osteopontin is an activator of human adipose tissue macrophages and directly affects adipocyte function.
Zeyda M, Gollinger K, Todoric J, Kiefer FW, Keck M, Aszmann O, Prager G, Zlabinger GJ, Petzelbauer P, Stulnig TM
Endocrinology 2011 Jun;152(6):2219-27
Endocrinology 2011 Jun;152(6):2219-27
Thrombin-cleaved osteopontin regulates hemopoietic stem and progenitor cell functions through interactions with alpha9beta1 and alpha4beta1 integrins.
Grassinger J, Haylock DN, Storan MJ, Haines GO, Williams B, Whitty GA, Vinson AR, Be CL, Li S, Sørensen ES, Tam PP, Denhardt DT, Sheppard D, Choong PF, Nilsson SK
Blood 2009 Jul 2;114(1):49-59
Blood 2009 Jul 2;114(1):49-59
An interstitial deletion at 3p21.3 results in the genetic fusion of MLH1 and ITGA9 in a Lynch syndrome family.
Meyer C, Brieger A, Plotz G, Weber N, Passmann S, Dingermann T, Zeuzem S, Trojan J, Marschalek R
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Feb 1;15(3):762-9
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Feb 1;15(3):762-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ITGA9 monoclonal antibody (M01), clone 3E4. Western Blot analysis of ITGA9 expression in HepG2.
