HPA018325

UPF3A antibody from Sigma-Aldrich
HUPF3A, RENT3A, UPF3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018325
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018325, RRID:AB_1858638
Product name
Anti-UPF3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018325
Antibody type
Polyclonal
Antigen
Regulator of nonsense transcripts 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQES
EAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKG
PGQDRGKK
Storage
-20C
Provider Type Product Number
- No reagents -