HPA003865

MALT1 antibody from Sigma-Aldrich
MLT, PCASP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003865
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003865, RRID:AB_1079300
Product name
Anti-MALT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003865
Antibody type
Polyclonal
Antigen
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKR
NDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQ
HSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMG
KCHLTKGKQALEIRSSLSEKRALTDPIQGT
Storage
-20C
Provider Type Product Number
- No reagents -