Antibody data

Product number
H00006557-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006557-M03, RRID:AB_1137452
Product name
SLC12A1 monoclonal antibody (M03), clone 4H4
Provider product page
Abnova Corporation - H00006557-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC12A1.
Antigen sequence
AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEY
YRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSA
DRVANGDGIPGDEQAENKEDDQA
Isotype
IgG
Antibody clone number
4H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -