Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310136 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC12A1 antibody: synthetic peptide directed towards the N terminal of human SLC12A1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit
- Host
- Rabbit
- Antigen sequence
NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFA
IFFPA ATGILAGANI- Vial size
- 50 µg
Submitted references Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension.
Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells.
Stec DE, Drummond HA, Gousette MU, Storm MV, Abraham NG, Csongradi E
Journal of the American Society of Nephrology : JASN 2012 May;23(5):834-41
Journal of the American Society of Nephrology : JASN 2012 May;23(5):834-41
Heme oxygenase attenuates angiotensin II-mediated superoxide production in cultured mouse thick ascending loop of Henle cells.
Kelsen S, Patel BJ, Parker LB, Vera T, Rimoldi JM, Gadepalli RS, Drummond HA, Stec DE
American journal of physiology. Renal physiology 2008 Oct;295(4):F1158-65
American journal of physiology. Renal physiology 2008 Oct;295(4):F1158-65
No comments: Submit comment
No validations: Submit validation data