ABIN629944

antibody from antibodies-online

Targeting: PSMA1 HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629944 - Provider product page
Provider: antibodies-online
Product name: anti-Proteasome (Prosome, Macropain) Subunit, alpha Type, 1 (PSMA1) antibody
Antibody type: Polyclonal
Antigen: PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
Description: Purified
Reactivity: Human, Mouse, Rat, Canine
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PSMA1 protein structure - ABIN629944 shown in red.