H00003569-B03P

IL6 antibody from Abnova Corporation
BSF2, HGF, HSF, IFNB2, IL-6

Antibody data

Product number
H00003569-B03P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003569-B03P, RRID:AB_1204541
Product name
IL6 purified MaxPab mouse polyclonal antibody (B03P)
Provider product page
Abnova Corporation - H00003569-B03P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IL6 protein.
Antigen sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGED
SKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE
TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSG
FNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA
RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASL
LTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR
QM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -