ABIN567197

IL6 antibody from antibodies-online
BSF2, HGF, HSF, IFNB2, IL-6

Antibody data

Product number
ABIN567197
Provider
antibodies-online
Product name
anti-Interleukin 1 Receptor-Like 2 (IL1RL2) (N-Term) antibody
Provider product page
antibodies-online - ABIN567197
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL1RL2 antibody: synthetic peptide directed towards the N terminal of human IL1RL2
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKD
DSLTC HLHFPKSCVL
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -