HPA003941

PIM1 antibody from Sigma-Aldrich
PIM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003941
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003941, RRID:AB_1079618
Product name
Anti-PIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003941
Antibody type
Polyclonal
Antigen
Proto-oncogene serine/threonine-protein kinase Pim-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLE
SQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVE
KDRISDWGELPNGTRVPMEVVLLKKVSSGFS
Storage
-20C
Provider Type Product Number
- No reagents -